PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000667G0080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family Nin-like
Protein Properties Length: 950aa    MW: 103258 Da    PI: 6.0957
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000667G0080genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85.3e-29602653152
           RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      aek+isle+l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  PH01000667G0080 602 AEKTISLEVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 653
                      589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.655592673IPR003035RWP-RK domain
PfamPF020423.4E-26605653IPR003035RWP-RK domain
SuperFamilySSF542772.55E-20845940No hitNo description
SMARTSM006666.6E-23855937IPR000270PB1 domain
PfamPF005647.8E-15855936IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.6E-24855936No hitNo description
PROSITE profilePS5174518.061855937IPR000270PB1 domain
CDDcd064077.74E-33856936No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 950 aa     Download sequence    Send to blast
MDLDPSSSSA AAAGGDGGGG GDVWPFDSFT TSLLFSSVSA SPPPLFSSVS ASPPPPPLPA  60
ASSSWLTPPS PLWLFDDRQL FPLEVGPALA VAAAAPEAAV AEEVHRARSG NSDTTSKRVE  120
QINSKCKFHL SLDDNSTDGA CLFKERLTRA LRYFKESTDQ HLLAQVWAPV KNGDRYVLTT  180
SGQPFVLDHQ SIGLLQYRAV SMMYMFSVDG DNAGELGLPG RVYKQKVPEW TPNVQYYRST  240
EYSRLNHAIS YNVHGTVALP VFDPSVQSCI AVVELIMTSK KMNYACEVDK VCKALEAVNL  300
KSTEILDHPN VQICNEGRQS ALVEILEILT VVCEEHKLPL SQTWVPCKYR SVLAHGGGVK  360
KSCLSFDGSC MGEVCMSTSD VAFHVIDARM WGFRDACVEH HLQKGQGVSG KAFIYHRPCF  420
SKDISQFCKL EYPLVHYARM FGLAGCFAIC LQSSYTGNDD YILEFFLPPS CRDEDDQNAL  480
LESILALMKQ CLRSLKVVGN GDSNEASLQI SNVLIIENED SKTNVHFENS EGCLRESPEG  540
DTHGGLYELD KGNSKVSERF LLADDNSQNN GTSVSRPNGS GASDSSLPHK SNKPPERRRG  600
KAEKTISLEV LQQYFSGSLK NAAKSLGVCP TTMKRICRQH GISRWPSRKI NKVNRSLSKL  660
KQVIESVQGS DAAFNLTSIT GPLPIPVGPS SDSPNIEKAS QSKVAEFSNP AVDGDRDSSL  720
QKSLENASHF GILMSQQGFI DNSNNVQLEA DKASHSRSSS GEGSINSRTS EGSCQGSPAN  780
QTFVCKPIAS TFLEPQPNPE VFTKGPFQEP ELPLSRMLVE DSGSSKDLKN LFTSAVDQPI  840
LAPPSNLMLM QNSGTVTIKA SFKEDIVRFR FPCSGSVSVL KDDVAKRLKM DVGMFDIKYL  900
DDDHEWVKLA CNADLEECLE ISRHSGSHVI RLLVSDVAAH LGSSCGSSG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565547.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA0A0E0JG460.0A0A0E0JG46_ORYPU; Uncharacterized protein
STRINGORGLA01G0077900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein